Protein Info for GFF942 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 33 to 226 (194 residues), 153.9 bits, E=5.9e-49
• PF08659: KR
  • amino acids 35 to 151 (117 residues), 32.3 bits, E=1.4e-11
• PF13561: adh_short_C2
  • amino acids 39 to 272 (234 residues), 173.1 bits, E=1.2e-54

Best Hits

Swiss-Prot: 37% identical to PECR_RAT: Peroxisomal trans-2-enoyl-CoA reductase (Pecr) from Rattus norvegicus

KEGG orthology group: None (inferred from 93% identity to pol:Bpro_5297)

MetaCyc: 36% identical to peroxisomal trans-2-enoyl-CoA reductase (Homo sapiens)
Trans-2-enoyl-CoA reductase (NADPH). [EC: 1.3.1.38]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• phytol degradation (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (25/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (25/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (25/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Fatty acid elongation in mitochondria

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.3.1.38

Protein Sequence (292 amino acids)

>GFF942 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNSADSQHPKFGPGDEALAALPTVYRDDLFAGKVVLVSGAGSGIGKAIAFLFARLGATLA
ICGRKADKLEDCAEKLRALSGREVITYPMTIRDPEQVDAMLSAVWERLGGVDVLVNNAGG
QFAAHAMDFNVKGWNAVIDTNLNGSWYMMQGAARRWVEQGRPGNIVNITAAIDRGLTGMA
HTTASRAGVIALSRTLAIEWAEHGIRLNCIGAGAIESNGFNNYREENVSTFYSCNPMKRA
GDVQDIAEAVVYLAAPSGKFITGEVLNVEGGMLLWGEFWPAGKPDYFKVDQE