Protein Info for GFF94 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable signal peptide protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04264: YceI" amino acids 24 to 180 (157 residues), 110.2 bits, see alignment E=6e-36

Best Hits

KEGG orthology group: None (inferred from 58% identity to aav:Aave_3506)

Predicted SEED Role

"Probable signal peptide protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>GFF94 Probable signal peptide protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNNRLLIGITAVALTGAGAAMAQKLEPAQSEIAFTFRQMGVPVEGRFTRFSGLVDFDPRK
PEVGKVALRIDTGSARFGSAETDVEAVRSEWLHVARFPQASLDSMAIKSAGPGRYELTGR
LSIKGTTRDVQVPVTLARSGAVTIATGAFTVKRLEFKIGEGDWSDTSMVANEVQVKFKLA
LSGMAAL