Protein Info for GFF94 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Polysaccharide deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01522: Polysacc_deac_1" amino acids 228 to 366 (139 residues), 77.3 bits, see alignment E=5.2e-26

Best Hits

Swiss-Prot: 82% identical to YADE_ECOLI: Uncharacterized protein YadE (yadE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to sty:STY0197)

Predicted SEED Role

"Polysaccharide deacetylase" in subsystem Polysaccharide deacetylases or Predicted carbohydrate hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>GFF94 Polysaccharide deacetylase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVMRVVLILLFFFAGNVLAALPARYMQTTKDAAIWSQIGDKMVTVGNIRAGQILSVTPVA
ADYYAFKFGFGVGFIDKGHLESVQGKQKVEDGLGDLNKPLSNQNLVTWKDTPVYNAPDIS
SAPFGVLVDNLRYPIISKLKGRLHQTWYQIRIGDRLAYVNAMDAQEDNGIPILTYHHILR
DEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMYQLEDYIYNRANFPARAVAITFDD
GLKSVSRYAYPVLKQYDMKATAFIISSRIKRHPQKWNPRSLQFMSVSELRKISDVFDFQS
HTHFLHRVDGHRRPILYSRSYHNILFDFERSRRALAQFTPHVFYLSYPFGGYNATAIKAA
KDAGFHLAVTTVRGKVKPGDNPMLLKRLYILRTDSLETMSRLISNQPQG