Protein Info for PS417_04765 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 343 (332 residues), 173.3 bits, see alignment E=3.6e-55

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGA9 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PS417_04765 membrane protein (Pseudomonas simiae WCS417)
MTYRSKVAWIFLLGFALDLVNMFVATVAYPDIARELQASVTQLAWISNAYLLGLTVIIPL
SVWLAALMGERALIAASLLLFAGASVMVGQASSIETLIGWRALQGLGGGLLIPVGQAMAY
RHFPAAERSQLTARVMSVALLVPALSPALGGLIVDSLSWRWIFYANLPLALITLLLTLLW
ITPDVTAKLRPKLDVGRIFQQVRSPMLRTAMLIYLCIPGVFIGTSLIAILYLRGLGYDAT
QTGALMLPWALASALAIFLSKQLFNRCGPKPLLLAGMALQCVGILLLNAPALIIPAYLLM
GLGGSLCSSTAQTLAFVDIPAERMGHASALWNINRQVSFCLGAAALSALLSALDSFAITF
TMAAALTLLPLFAVLRLDASRVRSLLHPASEPHR