Protein Info for GFF938 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 295 (250 residues), 129.6 bits, see alignment E=6.5e-42

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 61% identity to bpt:Bpet1128)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>GFF938 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDPSGIFSTSYARDRALIRTRAQWVTLGLFIAILLFLPWFASARLVAVANLMLVTSIVVV
GLQITTGYAGQINLGQAAFMGVGAYAASVVEVKAGLPFWVAVPVAGLVAALAGWLFGMTA
ARIKGFYLALTTIAAQFIFHFIVLNLPSAWLGGVNGFSLEPARMGTFLFNTDRSLYYLFL
VVTMVMVIGAFGILRSRHGRAFVAVRDDDVAAGMMGVDVAGAKSRAFVLGAFYAGIGGAL
WAYQVRFVSVDQFTLFNSIWFIAMMIVGGLGSIVGALIGTVLIRGVQETITSLGPDLVER
IPSLSSDLIFASMNVFLGLIITLFLLLEPKGLMHRWNILKTNYRLWPFHH