Protein Info for GFF937 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 279 (271 residues), 99.5 bits, see alignment E=9.5e-33

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 65% identity to bpt:Bpet1127)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF937 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MIIEFINYTINGALLGLLYSLVAMGFVVIYRASKVFNMAIGEMIVLGAFLLWWAIQSRGM
HPVLGIAVALCISVLIGLVIERLLFRRLIGESVFSMIMVTIGLLILMRGLVLAIWGPQER
QFPAIFPLTPIILGEMIIPRSLAIGGLIAVLAAVALHWFFNRSRSGLAMSAVAEDHQIAL
AMGISVRRSIAFAWALGGVLSVITSMVYLSGKSLTFLSSEIGFAALPVALLAGLESIGGL
LLAGIIVGVVQGLTAAYIDPLIGGNAAAVVPYIFMLVVLVVRPTGMFGWKRIERV