Protein Info for GFF933 in Variovorax sp. SCN45

Annotation: YgfD: protein that forms a complex with the methylmalonyl-CoA mutase in a pathway for conversion of succinyl-CoA to propionyl-CoA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00750: LAO/AO transport system ATPase
  • amino acids 20 to 339 (320 residues), 328.8 bits, E=1.4e-102
• PF03308: MeaB
  • amino acids 24 to 309 (286 residues), 359.9 bits, E=7.1e-112

Best Hits

KEGG orthology group: K07588, LAO/AO transport system kinase [EC: 2.7.-.-] (inferred from 94% identity to vpe:Varpa_3762)

Predicted SEED Role

"putative periplasmic protein kinase ArgK and related GTPases of G3E family"

KEGG Metabolic Maps

• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.-.-

Protein Sequence (349 amino acids)

>GFF933 YgfD: protein that forms a complex with the methylmalonyl-CoA mutase in a pathway for conversion of succinyl-CoA to propionyl-CoA (Variovorax sp. SCN45)
VLNSVQALEATVTGTEGMAQRRAIAKAITLLESTRADHRTQADELLTALLPRTGSSFRLG
ISGVPGVGKSTFIETLGLLLIGKGHRVAVLTIDPSSTVSGGSILGDKTRMERLSVHERAY
IRPSPSSGTLGGVAEKTREAMLVCEAAGYDIVIVETVGVGQSETAVAGMTDMFVLMQLPN
AGDDLQAIKKGVMEIADLVVINKADIDKDAATRAQAQITSALRLFGHQGNPDHAHAVHDA
HSGAEVRFWLPRVLQLSALAGTGVDAFWDAVTQFRQLQTANGKLGRRREKQATAWMWERI
DAGLKQAFRHHPQVRELLPQLTQQVAQGTLPASTAARSLLAAAAVTAKP