Protein Info for GFF931 in Xanthobacter sp. DMC5

Annotation: Glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details amino acids 151 to 180 (30 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 8 to 199 (192 residues), 174.1 bits, see alignment E=1.5e-55 PF02660: G3P_acyltransf" amino acids 16 to 189 (174 residues), 180 bits, see alignment E=2.1e-57

Best Hits

Swiss-Prot: 70% identical to PLSY_NITHX: Glycerol-3-phosphate acyltransferase (plsY) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 81% identity to xau:Xaut_3917)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>GFF931 Glycerol-3-phosphate acyltransferase (Xanthobacter sp. DMC5)
MPDTPPALVLLIALAFGYLLGSVPFGLILTRFAGTKDLRSIGSGNIGATNVLRTGRKDLA
AATLLLDALKGTAAVLVARHFAGETAAMAAAVGAFLGHIAPVWLRFKGGKGVATFLGVTI
GLFWPAAIAFAVVWLGAAYFTRYSSLSALMASVATVVAAMALGNNNLAVLLAVLAILLWL
KHHENIRRLLEGTEGKIGAKG