Protein Info for PS417_00470 in Pseudomonas simiae WCS417

Annotation: glutamate:protein symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 72 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 321 to 347 (27 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details PF00375: SDF" amino acids 8 to 410 (403 residues), 412.3 bits, see alignment E=1e-127

Best Hits

Swiss-Prot: 74% identical to GLTP_ECOLI: Proton/glutamate-aspartate symporter (gltP) from Escherichia coli (strain K12)

KEGG orthology group: K11102, proton glutamate symport protein (inferred from 98% identity to pfs:PFLU0093)

MetaCyc: 74% identical to glutamate/aspartate : H+ symporter GltP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-122A; TRANS-RXN-162

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TU28 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PS417_00470 glutamate:protein symporter (Pseudomonas simiae WCS417)
MKKAKLSLAWQILIGLVLGIAIGAVLNHFSAEKAWWISNVLQPAGDIFIRLIKMIVIPIV
ISSLIVGIAGVGDAKKLGRIGVKTILYFEIVTTIAIVVGLLLANLFHPGAGIDMSTLGTV
DISKYTATAAEVQHEHAFIETILNLIPSNIFAAVARGEMLPIIFFSVLFGLGLSSLKPEL
REPLVTMFQGVSESMFKVTHMIMKYAPIGVFALIAVTVANFGFASLLPLAKLVILVYVAI
LFFAFVILGLIARLFGFSVVKLMRIFKDELVLAYSTASSETVLPRVIEKMEAYGAPKAIC
SFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSVGQQLMLVLTLMVTSKGIAGVPGVS
FVVLLATLGSVGIPLEGLAFIAGVDRIMDMARTALNVIGNALAVLVISRWEGMYDDAKGE
RYWNSLPHWRSKDAAPVAQATRS