Protein Info for GFF928 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acetyl-CoA acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF00108: Thiolase_N" amino acids 5 to 118 (114 residues), 47.6 bits, see alignment E=2.3e-16 PF22691: Thiolase_C_1" amino acids 258 to 383 (126 residues), 130.9 bits, see alignment E=4.5e-42 PF02803: Thiolase_C" amino acids 272 to 363 (92 residues), 40.2 bits, see alignment E=3.8e-14

Best Hits

KEGG orthology group: None (inferred from 77% identity to mpt:Mpe_A0178)

MetaCyc: 59% identical to 3-oxoacyl CoA thiolase (Aromatoleum aromaticum EbN1)
Acetyl-CoA C-acyltransferase. [EC: 2.3.1.16]

Predicted SEED Role

"Acetyl-CoA acetyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16

Use Curated BLAST to search for 2.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>GFF928 Acetyl-CoA acetyltransferase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNQKVVVAGVGMVPFTKPGASEPYHVMGERAVRQALADARVEYAMIQQAYVGYVYGDSTC
GQRALYPVGMSGIPIVNVNNNCSTGSTALFLARQAVESGAVECVLALGFEQMAAGAIKAQ
FEDRPTPFEEFDRATAELVGRPEIPLAIRYFGGAGKAHMDKYGTKLETFASIRAKASRHA
ANNPLALLRKEISVDDVMNAPVLWEGVMTRLMACPPTCGAAAAVICSEAFAKKHGLDTRV
SIVAQAMATDLPSTFESHDMMRVVGFDMARDAAQKVYQQAGIGPQDVNVVELHDCFAQNE
LITYEALGLCPPGGAEKFVLDGDNTYGGKVVTNPSGGLLSKGHPLGATGLAQCYELTHQL
RGTADKRQVQGARVALQHNLGLGGACVVTLYQAA