Protein Info for GFF918 in Xanthobacter sp. DMC5

Annotation: Chorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00033: chorismate synthase
  • amino acids 10 to 358 (349 residues), 414.7 bits, E=1.4e-128
• PF01264: Chorismate_synt
  • amino acids 10 to 354 (345 residues), 425 bits, E=7.3e-132

Best Hits

Swiss-Prot: 90% identical to AROC_XANP2: Chorismate synthase (aroC) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01736, chorismate synthase [EC: 4.2.3.5] (inferred from 90% identity to xau:Xaut_4138)

MetaCyc: 59% identical to chorismate synthase (Escherichia coli K-12 substr. MG1655)
Chorismate synthase. [EC: 4.2.3.5]

Predicted SEED Role

"Chorismate synthase (EC 4.2.3.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.5

Protein Sequence (371 amino acids)

>GFF918 Chorismate synthase (Xanthobacter sp. DMC5)
MSFNTFGHMFRVTTFGESHGVAIGCVVDGCPPNVRFTIDEVQAALDRRRPGQSRFTTQRR
EPDEVKVLSGTLPHPEGGLVTTGTPIALLIENVDQRSKDYADIAGAYRPGHADFTYDIKY
GIRDHRGGGRSSARETATRVAAGAIAAKVLPGVTVRGAVVRIGEIEIDRSRWDWDEVGNN
PFFCPDPGTVPLFEDYLDGIRKAGSSVGAVVELVAEGVPPGLGAPLYAKLDGDLAAALMG
INATKGVEIGEGFNAARLTGEQNADEMRLGNEGRPHFLANHAGGILGGISTGAPIIARFA
VKPTSSILTPRQTVDRTGQETDIFTKGRHDPCVGIRAVPVGEAMVWCVLADHLIRHRGQV
GQTPAWPFTQG