Protein Info for GFF913 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) / ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF00005: ABC_tran" amino acids 31 to 189 (159 residues), 101.4 bits, see alignment E=2.7e-32 amino acids 309 to 458 (150 residues), 108.8 bits, see alignment E=1.4e-34 PF08352: oligo_HPY" amino acids 240 to 273 (34 residues), 19.6 bits, see alignment (E = 4e-07) amino acids 510 to 542 (33 residues), 27.1 bits, see alignment (E = 1.8e-09)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 67% identity to bra:BRADO2620)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>GFF913 ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) / ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MNTPSNQSARPVLSVEHLKIELRHGARPLVHDLSFEVKPGEFLAVVGESGSGKTMAARAI
LQLLPPGILQTGGRIVFDGEDLAARDPKAMRPIRGPGIGMVFQEPMVSLNPVHRIGEQMA
EGLRMHTQLPAAEIRARILDMLRRVQIADPERCMHAYPHEFSGGMRQRIMLASVMLLKPR
LLIADEPTTALDTLSQREVLDLMVGLARDNGTAVLLITHNLGLVGRYAQRAIVLEKGQLV
ETGDVPGILVAPKQPYTRKLVDALPRRQAAKPQGDAPRQPLVQVRSLCVSFSGARAGLFK
RHAPVHVIDSLDLDIHPGEMVALVGGSGSGKTTLGRAILRLAPSQSGQILFRGEDVRTAG
RAALHRFRLACQLVFQDPFSSLDPRMRVQDIVAEPLRHLPSLDAAARVRRVKETLDEVGL
DGLGARYPHELSGGQRQRVAIARALVRRPAFVVADEPVSALDMTIQAQVLSLFQSLQQHH
GFACLFISHDLAAVEQIADRVIVMERGRIVEQGARDAVFDDPRHAYTQALLAATPRPLAS
LDIAPAAISEKAFA