Protein Info for GFF906 in Variovorax sp. SCN45

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00190: Cupin_1" amino acids 48 to 135 (88 residues), 31.1 bits, see alignment E=2.4e-11 PF07883: Cupin_2" amino acids 65 to 123 (59 residues), 48.8 bits, see alignment E=7.1e-17 PF02311: AraC_binding" amino acids 70 to 124 (55 residues), 34.3 bits, see alignment E=2.7e-12

Best Hits

KEGG orthology group: None (inferred from 67% identity to ppw:PputW619_3088)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>GFF906 Transcriptional regulator (Variovorax sp. SCN45)
MKPLTATALHGLLLIASAAHAQDTMTVTRHGTQPSAKAPAQNFTGAVRVDPLFAATAPSR
VAGAYVTFEPGSRSAWHTHPLGQTLVVTAGSGWVQQEGGRRQELRPGDVVWTPPGVKHWH
GATAANGMTHMAIQESLDGRNVEWQEKVSDEQYGK