Protein Info for GFF902 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 310 to 333 (24 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 235 (213 residues), 93 bits, see alignment E=9.4e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>GFF902 hypothetical protein (Sphingobium sp. HT1-2)
MGSAYWGELRMHWRPLLAATMGLGFGIGLSAYTMSLFAPKMIGEFGWEKSQFALLGSFGL
LMLIMQPITGRLTDRFGVRAVSAVGVLAGPLAYLGFAFQPGSIRAFFAVAVLQIILGTLT
TSPVYTRIVAERFERARGLAFSIVMTGPPLVGAVIAPLLGGFIESQGWRNGYLLMGGVTL
VFGLIAVLLTPAHIGVHPHEEVEEAGTPAPVGSRVIFRNPAFWVLIVGMVLVNFPQGLAS
AQMKLVLMDSGAASQTATWLISIYAIGVLLGRFACGLSLDRMPPHHVAALALAMPAIGMA
LMASPLDATIVLALSVAMMGLAQGAEGDIAAYLVSRRFGLGVFSLVMGFVGAAIAGGAAL
GSLTLSLTLSIWGSYAPFLALSACVTLAGAALFLTLGRRPPTMEPVYA