Protein Info for GFF9 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 57 to 81 (25 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 164 to 192 (29 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 235 (166 residues), 82 bits, see alignment E=2.3e-27

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 36% identity to mil:ML5_4657)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF9 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKKLIIQTTSVLTFLVLWKGYVTLAGVSPLVLPAPEAVFMALYKLMQQPDTYFHIKTTLY
ECLGGFTLAVFFGTVLGQVLGRIQILDTIFKPFIVALQLTPKVALIPLFILWFGFGLESK
IVISAVMGFFPVFSNSYLGAKSVDNGLSEVFTVGHALMRKRFRLLVVPASLPYILTGMEM
AIVLSIIGAVVSEFVAGSRGLGFLATVKLQEMQVDMLFAVVILLASIGFILYFGVGSLRK
VLVPWHESAKSQGVA