Protein Info for GFF897 in Variovorax sp. SCN45

Annotation: putative oxygenase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF17885: Smoa_sbd" amino acids 148 to 255 (108 residues), 156.2 bits, see alignment E=1.5e-50

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_4903)

Predicted SEED Role

"putative oxygenase subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF897 putative oxygenase subunit (Variovorax sp. SCN45)
MKRIAIVGAGQSGLQLGLGLLGAGYEVTMFSNRTGEDIRNGKVMSSQCMFNTSLQIERDL
GLDHWAEECPTVDGIGLAVPHPEQKGAKAIDWAARLHSSAQSVDQRVKIPAWMAEFQKKG
GELVFKDAGIDELETCTQTQDLTLVASGKGEISKLFERDAHKSTFDKPQRALALTYVKGM
KPREPFSAVCFNLIPGVGEYFVFPALTTSGPCEIMVFEGIPGGPMDCWADVKTPQEHLAR
SKWILDTFTPWEAERCKDIELTDDNGILAGRFAPTVRKPIATLPSGRKVLGLADVVVLND
PITGQGSNNAAKCADVYFKSILARGDGAADASWMQQTFDRYWFGYSQWVTQWTNMLLAPP
PPHVLKLLGSAGAMPTLASAFANGFDDPRTFFPWFADPVEADRYIDTCAAAAA