Protein Info for GFF894 in Xanthobacter sp. DMC5

Annotation: 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 149 to 173 (25 residues), see Phobius details PF01479: S4" amino acids 1 to 44 (44 residues), 33.9 bits, see alignment 2.1e-12 TIGR00478: TlyA family rRNA methyltransferase/putative hemolysin" amino acids 2 to 231 (230 residues), 204.8 bits, see alignment E=5.9e-65 PF01728: FtsJ" amino acids 56 to 236 (181 residues), 139.7 bits, see alignment E=1e-44

Best Hits

KEGG orthology group: K06442, putative hemolysin (inferred from 76% identity to xau:Xaut_4163)

Predicted SEED Role

"RNA binding methyltransferase FtsJ like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF894 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA (Xanthobacter sp. DMC5)
MRLDRLLVERGLFDSRARAQAALAAGLVKVDGVVVAKASAEIDVAARIEAEDVHDYVSRG
ALKLAAGLDAFAIDPAGTEALDVGSSTGGFTEVLLRRGARRVHAVDVGRDQFHARLRDDP
RVRLFEETDIRTFDHAVVPGGFDLIVIDVSFIPLALVLPAALALAAPAARLVALVKPQFE
AGRAFVRKGVVRDAAVREEVCAKVEQEIAAQGWRLIGRIPSPIAGGDGNQEYLVGAIRP