Protein Info for PS417_04530 in Pseudomonas simiae WCS417

Annotation: glycerate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF00389: 2-Hacid_dh" amino acids 21 to 318 (298 residues), 88.4 bits, see alignment E=3.4e-29 PF02826: 2-Hacid_dh_C" amino acids 112 to 290 (179 residues), 169.2 bits, see alignment E=6e-54

Best Hits

KEGG orthology group: K00018, glycerate dehydrogenase [EC: 1.1.1.29] (inferred from 94% identity to pfs:PFLU0920)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.29 or 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZT9 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PS417_04530 glycerate dehydrogenase (Pseudomonas simiae WCS417)
MTNNRRAVFLDHPSLDLGDLDLSELRDSFSELQLFADTTPQNVIERVQGAHVVISNKIAL
NTATLAACPELKLILVSATGTNNVDLEAARAHGITVSNCQGYGTPSVAQHTIMLLLNLAT
RLKDYQRDVSAGKWQEAKQFCLLDHPIVELEGKTLGLLGHGELGGAVARLAEAFGMRVLL
GAIPGRPARADRVPLDELLAQVDALTLHCPLNEHTRDFIGARELALLKPGAFVVNTARGG
LINEQALADALRSGHLGGAATDVLSVEPPVHGNPLLAGDIPRLIVTPHNAWGSREARQRI
VGQLAENARGFFNGAPLRVVS