Protein Info for GFF890 in Xanthobacter sp. DMC5

Annotation: Lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 2 to 117 (116 residues), 76.3 bits, E=2.7e-25
• TIGR00068: lactoylglutathione lyase
  • amino acids 2 to 122 (121 residues), 123.5 bits, E=2.5e-40
• PF13669: Glyoxalase_4
  • amino acids 5 to 103 (99 residues), 37.1 bits, E=3.4e-13

Best Hits

Swiss-Prot: 45% identical to LGUL_NEIMB: Lactoylglutathione lyase (gloA) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 94% identity to xau:Xaut_4172)

MetaCyc: 39% identical to lactoylglutathione lyase (Escherichia coli K-12 substr. MG1655)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• methylglyoxal degradation I (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Protein Sequence (140 amino acids)

>GFF890 Lactoylglutathione lyase (Xanthobacter sp. DMC5)
MRFLHTMVRVTDIDQSLDFYCNKLGLKEVRRKEVPQGRYTLVFLAPPGQENVAEIELTYN
WDKEPYGEGRNFGHLAFEVEDIYGLCERLMASGVTINRPPRDGYMAFVRSPDNVSVELLQ
KGGPKPPAEPWASMPNTGKW