Protein Info for GFF890 in Sphingobium sp. HT1-2

Annotation: Alcohol dehydrogenase (EC 1.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF08240: ADH_N" amino acids 29 to 132 (104 residues), 51.2 bits, see alignment E=2e-17 PF00107: ADH_zinc_N" amino acids 172 to 296 (125 residues), 87.9 bits, see alignment E=8.6e-29 PF13602: ADH_zinc_N_2" amino acids 204 to 330 (127 residues), 67.3 bits, see alignment E=4.1e-22

Best Hits

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>GFF890 Alcohol dehydrogenase (EC 1.1.1.1) (Sphingobium sp. HT1-2)
MTNMLTAIARGGEGIEGIAIHSVPIPVAGPGEALVRLKAATLNFRDLIIARGMMAGLAKE
PDYVPLSCATGEVVAVGEGVSRVKPGDRVNPIFALGWLEGRQPSMAMLGGSADGVARQYA
IFPAESLCIVPDALGDLEAATLTCAGLTAWNALFLPRPIQRGEWILCQGTGGVSIAALQL
AKAAGAHVAITSSSDAKLARARALGADICINYRSDPDWPAAIRQALGGRGIDIVVDVVGA
SQVETAASLLNPGGVIAAIGMLGSEFSWHLADVGGHPVARISVGNRAEHAAMLAFCAQHR
IRPVVDAVYDLTRLADACRHLESGEFFGKIGINLL