Protein Info for GFF889 in Xanthobacter sp. DMC5

Annotation: NAD-dependent protein deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 29 to 208 (180 residues), 130.6 bits, E=3.2e-42

Best Hits

Swiss-Prot: 64% identical to NPD1_BRADU: NAD-dependent protein deacetylase 1 (cobB1) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 85% identity to xau:Xaut_4173)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Protein Sequence (256 amino acids)

>GFF889 NAD-dependent protein deacetylase (Xanthobacter sp. DMC5)
MIYEGDLKGAQQRLRELLDGSARAVAFTGAGISTECGIPDFRSPGGLWTQNKPIPFDVFV
AHKAARNEAWRRKFAMEEAFAGAQPGRGHRALARLLGHGRLAGVITQNIDGLHQASGVPD
DALVELHGNGTYATCLDCGARYELAWVKERFDAAGGIAPDCPACDGPVKAATISFGQAMP
EREMARADALTKVSDLFIVIGSSLVVFPAAGFPLKARQKGARLIILNREPTEFDEVADLV
VRAEIGDVLAPFAGDG