Protein Info for GFF884 in Sphingobium sp. HT1-2

Annotation: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF14696: Glyoxalase_5" amino acids 7 to 121 (115 residues), 116.9 bits, see alignment E=1.7e-37 TIGR01263: 4-hydroxyphenylpyruvate dioxygenase" amino acids 13 to 341 (329 residues), 367.7 bits, see alignment E=3.9e-114 PF00903: Glyoxalase" amino acids 152 to 261 (110 residues), 47.3 bits, see alignment E=5.3e-16

Best Hits

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 88% identity to sjp:SJA_C2-00370)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.27

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>GFF884 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (Sphingobium sp. HT1-2)
MTIDPANPLGLNGFEFVEFTSPEPEKMAAQFEQLGFTATHRHPTKNITRYKQGRINLMLN
RDDAGRVAAFRGEHGPSASAMAFRVADPDAALRWALDHGGKPTDENDTVIQGIGGSYLYF
MPDGGDPYADWAEYPGWREAEARNNVGLDLLDHLTHNVKRGQMRVWSEFYRTLFGFEEQK
YFDIKGKATGLFSQAMIAPDKAIRIPLNESQDDKSQIEEFIRDYNGEGIQHIALTTANIY
DTVERLRARGVRLQDTIETYYELVDQRVPGHGEDLERLKRNRILIDGNVGEEGILLQIFT
ETMFGPIFFEIIQRKGNEGFGNGNFQALYESIELDQIRRGVITVDE