Protein Info for GFF88 in Variovorax sp. SCN45

Annotation: Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 304 to 321 (18 residues), see Phobius details amino acids 326 to 343 (18 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 382 to 396 (15 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 431 to 452 (22 residues), see Phobius details PF03062: MBOAT" amino acids 149 to 343 (195 residues), 94 bits, see alignment E=5.7e-31

Best Hits

KEGG orthology group: None (inferred from 58% identity to bav:BAV2624)

Predicted SEED Role

"Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)" in subsystem Alginate metabolism (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>GFF88 Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-) (Variovorax sp. SCN45)
VVFASLEFLAVFLPAFLLLYALTPARAKNVVLLLASWLFYGWWSPLFLLLFIALTALAWA
GGLLVERAGPNRRGMLVAFIVLNLGVLVWFKYANIVVETFNAALLHAGAMPVAWQRIALP
IGLSFTVLQAISYLVDVHRGKFPAERRPIDFATYLAMFGHLVAGPIIRYDWVRQRLAHRA
VHASAFATGARRFMIGMTMKVLVADTLSPVVEQVFSSTHPSLADAWLGCLAYTLQLFFDF
AGYSAMAIGIGAMLGFRFPENFDRPYLARNLAQFWRRWHISLSSWLRDYLYVPLGGSRKG
TRRTVLNLMLTMAIGGLWHGADSWNFLYWGLAQGMGLSVVHLCRARGLGLPAPLAHIATM
LFVMLGWTLFRSPDFAVACDMLAGQFGAHGVALGAALSNMLRLPVVLAYLLGIAWVLAPA
VVSARRHAGNAGAVLATLAPIAGFLLSLALVSSRGTVPFLYFQF