Protein Info for GFF865 in Xanthobacter sp. DMC5

Annotation: Protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF01135: PCMT" amino acids 15 to 198 (184 residues), 126.6 bits, see alignment E=2.4e-40 PF00398: RrnaAD" amino acids 62 to 130 (69 residues), 38.1 bits, see alignment E=1.9e-13 PF05175: MTS" amino acids 73 to 154 (82 residues), 24 bits, see alignment E=5.6e-09 PF13649: Methyltransf_25" amino acids 85 to 161 (77 residues), 28.3 bits, see alignment E=4.9e-10

Best Hits

Swiss-Prot: 33% identical to PIMT_DESAD: Protein-L-isoaspartate O-methyltransferase (pcm) from Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 87% identity to xau:Xaut_4234)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>GFF865 Protein-L-isoaspartate O-methyltransferase (Xanthobacter sp. DMC5)
MIDYVELRRGMVDSQVRTNNVTDPGIVGAMLEIPRELFVPAQLKSLAYIDDDLALTSGSP
ARYLIEPMILARLIQEADVQEHDHVLDIGGGTGYSAAVLSRLAQQVVAVEEDAGLAAAAT
ATLAEIGVANVAVMLGPLNAGWKAEAPYDLVLLNGSVDEVPAALFDQVKEGGRLVAVVGH
GGAGKACVFTKVAGSVSERVAFNAAVPALPGFKAAPRFTF