Protein Info for GFF862 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Possible monoamine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00890: FAD_binding_2" amino acids 4 to 40 (37 residues), 22.7 bits, see alignment 8.2e-09 PF13450: NAD_binding_8" amino acids 7 to 71 (65 residues), 62 bits, see alignment E=7.8e-21 PF01593: Amino_oxidase" amino acids 12 to 97 (86 residues), 64.7 bits, see alignment E=1.5e-21 amino acids 103 to 342 (240 residues), 78.5 bits, see alignment E=9.8e-26

Best Hits

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 54% identity to rde:RD1_0535)

Predicted SEED Role

"Possible monoamine oxidase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>GFF862 Possible monoamine oxidase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLTDTLIIGGGLSGLALAAKLAAQGRDFLLVEARDRLGGRILTVREGAAHFDLGPTWFWP
GQPRIAALTERLGLSRFDQFCQGDVIFENEQGRVHRGRGYASTQGAWRLEGGLGALIAAL
ENEVPAQRRRVSTTIRMLTRAAPGIIATSEDGVSIQARRVVLALPPRMAVRMSFTPTLPI
AALTELEGIATWMAGHAKAVAVYDRPFWLEAGLSGDAMSRHGPVVEIHDASPASGGPYAL
FGFIGVPPRARSDQQALRRQIQAQLIRLFGPEAATPSILCLKDWAYDRLTATELDGQAPH
VNSQYGLPRVLNGLWDGDLILAGTEVAPKFGGYLEGALEASELALANLGHIER