Protein Info for PS417_04355 in Pseudomonas simiae WCS417

Annotation: organic solvent tolerance protein OstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03002: lipopolysaccharide transport periplasmic protein LptA" amino acids 24 to 173 (150 residues), 146.3 bits, see alignment E=2.7e-47 PF03968: LptD_N" amino acids 34 to 147 (114 residues), 87.6 bits, see alignment E=3.6e-29

Best Hits

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 98% identity to pfs:PFLU0884)

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAA6 at UniProt or InterPro

Protein Sequence (177 amino acids)

>PS417_04355 organic solvent tolerance protein OstA (Pseudomonas simiae WCS417)
MRLVKTLPILLGLGAALGSVSAWALPNDSQQPIHISADDAQLDDKQGVATYTGGVIITQG
SMKITGNTVTLTRTAAGDIDVVTSVGNLAYFEQKQSPTDTGPMKGYGKTIQYHAQQNRIV
LIDQAKVLSPDGNSTEGEKITYDTVKQIANAGRANGSKVTAPRPRIDMVIQPKKKAE