Protein Info for GFF856 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868
Annotation: SSU ribosomal protein S18p @ SSU ribosomal protein S18p, zinc-independent
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS18_PHOLL: 30S ribosomal protein S18 (rpsR) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
KEGG orthology group: K02963, small subunit ribosomal protein S18 (inferred from 100% identity to dda:Dd703_0796)MetaCyc: 100% identical to 30S ribosomal subunit protein S18 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (75 amino acids)
>GFF856 SSU ribosomal protein S18p @ SSU ribosomal protein S18p, zinc-independent (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868) MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIK RARYLSLLPYTDRHQ