Protein Info for GFF851 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L-ribulose-5-phosphate 3-epimerase UlaE (EC 5.1.3.22) (L-ascorbate utilization protein E)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00542: putative hexulose-6-phosphate isomerase
  • amino acids 4 to 281 (278 residues), 497.8 bits, E=4e-154
• PF01261: AP_endonuc_2
  • amino acids 25 to 273 (249 residues), 188.9 bits, E=6.8e-60

Best Hits

Swiss-Prot: 100% identical to ULAE_SALTY: L-ribulose-5-phosphate 3-epimerase UlaE (ulaE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03079, L-ribulose-5-phosphate 3-epimerase [EC: 5.1.3.22] (inferred from 98% identity to ses:SARI_03247)

MetaCyc: 94% identical to L-ribulose-5-phosphate 3-epimerase UlaE (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 3-epimerase. [EC: 5.1.3.22]

Predicted SEED Role

"L-ribulose-5-phosphate 3-epimerase UlaE (EC 5.1.3.22) (L-ascorbate utilization protein E)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 5.1.3.22)

MetaCyc Pathways

• L-ascorbate degradation II (bacterial, aerobic) (7/7 steps found)
• L-ascorbate degradation I (bacterial, anaerobic) (5/5 steps found)
• L-lyxose degradation (4/4 steps found)
• superpathway of pentose and pentitol degradation (17/42 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.22

Protein Sequence (284 amino acids)

>GFF851 L-ribulose-5-phosphate 3-epimerase UlaE (EC 5.1.3.22) (L-ascorbate utilization protein E) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLSKQIPLGIYEKALPAGECWLERLRLAKTLGFDFVEMSVDETDARLARLDWSREQRLAL
VSAVAETGVRVPSMCLSAHRRFPLGSEDDAIRAQGLEIMRKAIQFAQDVGIRVIQLAGYD
VYYQQANDETRCRFRDGLKESVDMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWF
QLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLK
QSGYCGPYLIEMWSETAENPAAEVAKARDWVKARMASAGLVEAA