Protein Info for GFF845 in Xanthobacter sp. DMC5

Annotation: DNA-binding transcriptional regulator NtrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 98.9 bits, see alignment E=6.8e-32 PF00158: Sigma54_activat" amino acids 142 to 305 (164 residues), 181.3 bits, see alignment E=4.5e-57 PF14532: Sigma54_activ_2" amino acids 143 to 310 (168 residues), 89.1 bits, see alignment E=1.1e-28 PF07728: AAA_5" amino acids 166 to 276 (111 residues), 33.6 bits, see alignment E=1.3e-11 PF00004: AAA" amino acids 166 to 295 (130 residues), 23 bits, see alignment E=3.4e-08 PF02954: HTH_8" amino acids 412 to 451 (40 residues), 43.6 bits, see alignment 7e-15

Best Hits

Swiss-Prot: 88% identical to NTRX_AZOC5: Nitrogen assimilation regulatory protein NtrX (ntrX) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K13599, two-component system, NtrC family, nitrogen regulation response regulator NtrX (inferred from 92% identity to xau:Xaut_4397)

Predicted SEED Role

"Nitrogen regulation protein NtrX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>GFF845 DNA-binding transcriptional regulator NtrC (Xanthobacter sp. DMC5)
MAMDILIVDDEADIGELVAGILEDEGYSARTARDADGALGAIATRRPNLVFLDIWLQGSR
LDGLELLNEIKSQHPDLPVVMISGHGNIETAVAAIKRGAYDFIEKPFNADRLVMVTERAL
ETLRLKRELKELKQLTPHGRILIGRSSAIQQLKGTIERVGPTNSRILIVGPSGSGKELTA
RLIHSVSGRAQGPFVVLNSAAMTPERLEFELFGVAEGEGREQKRGALEEAHGGTLFLDEI
ADMPRETQNRVLRVLVEQTFTRVGSNDKVTVDVRIISSTGRNLEEEIAKGRFREDLYHRL
SVVPIRVPPLAERREDIPDLVDFFLDSISQTTGLPRRPIGEDAMAVLQSHDWPGNVRQLR
NNVERLLILAGGDPEATITAAMLPPDVGALVPTLPNGNGGEHLMGLPLREAREVFEREYL
AAQINRFGGNISRTAEFVGMERSALHRKLKALGVG