Protein Info for GFF843 in Xanthobacter sp. DMC5

Annotation: Trk system potassium uptake protein TrkH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 120 to 147 (28 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 441 to 467 (27 residues), see Phobius details

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 79% identity to xau:Xaut_4395)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>GFF843 Trk system potassium uptake protein TrkH (Xanthobacter sp. DMC5)
MANAARPLAAGIAAIGAFALLPMAVAARTGTGPVAVWLATSGFCLFLAGLLRFTTHGLEM
RLTRSGAVALVACMWLVLPLMATPAVAVVSGLSPLQAWFEALSAFTATGLTALHQGPASL
YVFLGLLQWAGGLLTVVTAVAVLAPAGLGGLPDRTPRGGSALDVVDLVRVLREIAPAYFG
ATVLAMLVLLASGETIYVAFTLATAVVSAGAHLPPEAQLALALDETPKWLLLPFLIFSAT
SVRWHRALITRRINAAPEQVESLVIIGWWVVLGIILGALLFRTDEMSSVDAVRDGLFTAA
SLISTSGIGPHEGTYANLPLGLVILVVLLGGGALSVAGGLKMLRLRAILLRTRGDLLRLV
YPHIVLPSALEGGVGSAMRGVWAGAASLAFLYGLCVIALSPGLPSLDAALAAAAAVVTNT
GPVYDAAGGGWPAMSSLPWGSVLVAGIGMVAGRLEIIGLFVFIHLAIWRT