Protein Info for GFF840 in Xanthobacter sp. DMC5

Annotation: GTPase HflX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 TIGR03156: GTP-binding protein HflX" amino acids 61 to 407 (347 residues), 453.1 bits, see alignment E=3e-140 PF13167: GTP-bdg_N" amino acids 65 to 151 (87 residues), 97.2 bits, see alignment E=1.4e-31 PF16360: GTP-bdg_M" amino acids 154 to 233 (80 residues), 103 bits, see alignment E=2.1e-33 PF01926: MMR_HSR1" amino acids 241 to 345 (105 residues), 72 bits, see alignment E=8.8e-24 PF19275: HflX_C" amino acids 386 to 468 (83 residues), 53.7 bits, see alignment E=3.7e-18

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 86% identity to xau:Xaut_4392)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF840 GTPase HflX (Xanthobacter sp. DMC5)
VIPGDDEALLPESGMDPDSPTSDMTQQPTRGGIDRRAPAVRCAVVTPVVSRRGRGGAPER
RSPEARLDEAVGLAAAIELDVVFSGLVSLSEIRPATYLGTGKVEELADVVKAEHVDLVFF
DAALSPVQQRNLEKAWSTKVVDRTALILEIFGMRARTKEGALQVELAHLNYQRSRLVRSW
THLERQRGGFGFLGGPGETQIEADRRLIGERIVRIEKELEQVKRTRGLHRASRKRVPYPI
VALVGYTNAGKSTLFNRLTRAEVMAKDLLFATLDPTLRAVDLPHGTRIILSDTVGFISEL
PTQLVAAFRATLEEVLEADLILHVRDISHPDTEAQAADVADVLEDLGVEVKDGGRVIEVW
NKIDRLSPEAREQVQNQTLRAGAGAPVAVSALTGEGTDDLLGVIERRITSGRVTLSVTLA
AEDGEGLGWLYRHGEVLERTTGEDGVLQVALRIPPERAGLVTRRFGVRRVHTM