Protein Info for GFF839 in Xanthobacter sp. DMC5

Annotation: Nucleoside triphosphate pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR00444: MazG family protein" amino acids 13 to 271 (259 residues), 301 bits, see alignment E=3.7e-94 PF03819: MazG" amino acids 30 to 103 (74 residues), 101.2 bits, see alignment E=3.1e-33 amino acids 181 to 244 (64 residues), 45 bits, see alignment E=1.1e-15 PF01503: PRA-PH" amino acids 158 to 231 (74 residues), 30 bits, see alignment E=5.8e-11

Best Hits

Swiss-Prot: 46% identical to MAZG_HAEIN: Nucleoside triphosphate pyrophosphohydrolase (mazG) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 83% identity to xau:Xaut_4391)

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>GFF839 Nucleoside triphosphate pyrophosphohydrolase (Xanthobacter sp. DMC5)
MQPSRDIARLIEIMAALRTPGTGCPWDLEQTFATIAPYTLEEAYEVADAIARADLPDLKE
ELGDLLLQVVFHARLAEEEGAFAFPDVVEAITTKLVRRHPHVFGDARDLSPEAVKGMWAE
IKAQEKAERAAARAVAGLAPEEGGKGTLSGVALPLPALTRALKLQEKASRVGFDWNDARQ
VLAKIREETEEVSQALDAGGTEAIRDEIGDLLFAVVNLARHADVDPETALRGTNEKFTRR
FGHVEAQLAADGRRPNDASLDEMEALWQDAKRLEKRSERAAE