Protein Info for GFF834 in Xanthobacter sp. DMC5

Annotation: Integration host factor subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF18291: HU-HIG" amino acids 4 to 97 (94 residues), 30.7 bits, see alignment E=2.9e-11 TIGR00987: integration host factor, alpha subunit" amino acids 5 to 97 (93 residues), 132 bits, see alignment E=4e-43 PF00216: Bac_DNA_binding" amino acids 6 to 95 (90 residues), 96.3 bits, see alignment E=1e-31

Best Hits

Swiss-Prot: 94% identical to IHFA_XANP2: Integration host factor subunit alpha (ihfA) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 94% identity to xau:Xaut_4386)

Predicted SEED Role

"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>GFF834 Integration host factor subunit alpha (Xanthobacter sp. DMC5)
MAGRTVTRADLCEAVYQQVGLSRTESAQLVEMVLKEIADCLARGETVKLSSFGSFVVRDK
GERIGRNPKTGQEVPIEPRRVMVFKPSSILKHRINGTEPDGTDED