Protein Info for PS417_04205 in Pseudomonas simiae WCS417

Updated annotation (from data): D-galacturonate transporter (MFS superfamily)
Rationale: Specific phenotype on galacturonate. This phenotype is conserved. There is also another putative hexuronate transporter that has a weaker phenotype on galacturonate (PS417_14775).
Original annotation: glucarate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 309 (293 residues), 173.5 bits, see alignment E=6.3e-55 TIGR00893: D-galactonate transporter" amino acids 19 to 428 (410 residues), 528.8 bits, see alignment E=4.5e-163

Best Hits

Swiss-Prot: 68% identical to GUDP_BACSU: Probable glucarate transporter (gudP) from Bacillus subtilis (strain 168)

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 98% identity to pfs:PFLU0851)

MetaCyc: 67% identical to galactarate/D-glucarate transporter GudP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-203; TRANS-RXN0-204; TRANS-RXN0-523

Predicted SEED Role

"D-galactarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA77 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PS417_04205 D-galacturonate transporter (MFS superfamily) (Pseudomonas simiae WCS417)
MQATKPTHVRYLILLMLFLVTTINYADRATIAIAGSSLQKDLGIDAVTLGYIFSAFGWAY
VAGQIPGGWLLDRFGSKKVYALSIFTWSLFTVLQGYVGEFGVSTAVVALFMLRFMVGLAE
APSFPGNARIVAAWFPTAERGTASAIFNSAQYFATVLFAPLMGWIVYSFGWQHVFIVMGV
IGIIFSLIWLKVIHSPRQHPMINEAEFNHIAANGAMVDMDQDKGKGKKTDGPKWDYIRQL
LTNRMMLGVYLGQYCINGITYFFLTWFPVYLVQDRGMTILKAGFIASLPAICGFIGGVLG
GVISDYLLRKGHSLTFARKAPIIGGLLISSSIVACNYVDIEWMVVGFMALAFFGKGVGAL
GWAVVSDTSPKQIAGLSGGLFNTFGNLASITTPIVIGYIISTTGSFKWALVFVGANALVA
VFSYLVIVGPIKRVVLKEPPTQGPELTRLTEAHS