Protein Info for GFF826 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details TIGR02281: clan AA aspartic protease, TIGR02281 family" amino acids 117 to 235 (119 residues), 132.9 bits, see alignment E=3.3e-43 PF13650: Asp_protease_2" amino acids 129 to 218 (90 residues), 83.1 bits, see alignment E=1.9e-27 PF13975: gag-asp_proteas" amino acids 130 to 221 (92 residues), 85.5 bits, see alignment E=3.1e-28

Best Hits

KEGG orthology group: K06985, aspartyl protease family protein (inferred from 80% identity to xau:Xaut_4258)

Predicted SEED Role

"CblY, a non-orthologous displasment for Alpha-ribazole-5'-phosphate phosphatase" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF826 hypothetical protein (Xanthobacter sp. DMC5)
MRSDRLLWLLLIGLFAGGVILAVNHEQGEVAGIDINKFGALVGQLSIAVFVGAAAWSIFR
GRIAESLMAAAFWLVLAALLALGYTYRDPLTQVGRKVLAEVAPGYAVNLAQTGTSMVEVT
RGSGGDFAVRAGINGSGVSMLVDTGASSVVLTHEAAKAVGLPVDFLKYDVPVDTAAGRTR
AAAVVLDTITIGSIVERHVPALVSPAGALRTSLLGMSFLSRLDAFEFRGDKLVMRGGK