Protein Info for GFF825 in Xanthobacter sp. DMC5

Annotation: Magnetosome protein MamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details PF01545: Cation_efflux" amino acids 16 to 214 (199 residues), 101.8 bits, see alignment E=2.2e-33

Best Hits

KEGG orthology group: None (inferred from 71% identity to xau:Xaut_4257)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF825 Magnetosome protein MamB (Xanthobacter sp. DMC5)
MRVPTPTDLQKERAILFAILLDFSVFVPYLVTVWRIGSLAMLAELLRGGLLLLVEGLALL
TLRAAHRGRMHFYDFGIGKLERMFAAAIGVLLLLAAVFILIKVMDSSESEPLPPFWVAAA
LGLVIYNLFTNLAPLVPLWRATRAGTSIIVLSQFRARIAKAVASVTVVVCVALDVLFPHT
EVGLAADDIGGLIGAAFMLVIGGAMISEALPDLLDRALAEPLQMKVNAALAAYFDRYEQL
ISVRTRKSGTIAHVEITVGFAPGRTIADVSSVTDALRQTLTAAIPDADVVVIAAPYDPET
RSA