Protein Info for GFF821 in Sphingobium sp. HT1-2

Annotation: 'Pyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), Alphaproteobacterial type' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01993: pyrimidine 5'-nucleotidase
  • amino acids 9 to 187 (179 residues), 187 bits, E=2.9e-59
• PF00702: Hydrolase
  • amino acids 9 to 182 (174 residues), 46.8 bits, E=4.9e-16
• PF13419: HAD_2
  • amino acids 12 to 188 (177 residues), 30.1 bits, E=5.2e-11
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 77 to 188 (112 residues), 51.6 bits, E=1.2e-17

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 92% identity to sch:Sphch_1970)

Predicted SEED Role

"Pyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), Alphaproteobacterial type" (EC 3.1.3.74)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (6/9 steps found)
• ginkgotoxin biosynthesis (1/3 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.74

Protein Sequence (223 amino acids)

>GFF821 'Pyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), Alphaproteobacterial type' transl_table=11 (Sphingobium sp. HT1-2)
MRADLAHVDTWIFDLDNTLYPAKADLFALIDVKMGEYIQGLLGCDPAEARIVQKRYFMEH
GTTLSGLMHHHGIEPREFLDYVHDISMERLAVDTALNAHIAALPGRRLIFTNGDATYAGR
VLDRLGLAGAFELIHDIHACRYVPKPDPSGYAELCSVHAVDPTRAAFFEDMARNLKPAKA
IGMTTIWVNNGSEAGNHDHHPDFIDFETDHLTPFLADIFGERP