Protein Info for GFF821 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR01251: ribose-phosphate diphosphokinase" amino acids 9 to 317 (309 residues), 413.2 bits, see alignment E=2.6e-128 PF13793: Pribosyltran_N" amino acids 9 to 125 (117 residues), 173.1 bits, see alignment E=2.5e-55 PF00156: Pribosyltran" amino acids 160 to 252 (93 residues), 72.3 bits, see alignment E=4.5e-24 PF14572: Pribosyl_synth" amino acids 206 to 317 (112 residues), 104.7 bits, see alignment E=9.2e-34

Best Hits

Swiss-Prot: 76% identical to KPRS_RALSO: Ribose-phosphate pyrophosphokinase (prs) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 89% identity to pol:Bpro_1293)

MetaCyc: 65% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF821 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQVQPPDFMIFTGNANPVLASEIAQHLGTQLGAANVGRFSDGEVTVEITQNVRARHVFVI
QSTCAPTNENLMELLIMVDALKRASAERISAVIPYFGYARQDRRPRSARVPISAKVVANL
LQTVGVSRVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLRQKNYPDVLIVSPDVGGVVR
ARALAKQLNCDMAIIDKRRPKANVSEVMHVIGDIEGRNCVIMDDMIDTAGTLVKAAEVLK
ERGAKNVYAYCTHPIFSGPAIERIAKGNALDEVVVTNTIPLSQAAQACSKIRQLSVAPLM
AETIARIASGESVMSLFADQDNLF