Protein Info for PS417_04165 in Pseudomonas simiae WCS417

Annotation: cytochrome C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 232 to 250 (19 residues), see Phobius details PF02167: Cytochrom_C1" amino acids 203 to 257 (55 residues), 24.3 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 99% identity to pfs:PFLU0843)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUU0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PS417_04165 cytochrome C (Pseudomonas simiae WCS417)
MKKLFVALMLAALPLLSFAAEHGGPELEKVDIDVSDKAAMQDGARTFANYCMGCHSAKFQ
RYERVADDLGIPHEMMLEKLVFTGAKIGDHMTIGMKPADAKTWFGAAPPDLTLVARVRGT
DWLYGYLKSFYEDPARPYGVNNRVFPNVGMPNVLVGLQGKQVVGCKQIQVVEDGKKQYDP
LTGTPLTHEACDQLKIETPGSLTDEQFDEKVKNLVTFLAYSANPVKLEHQRIGTYVLLYL
AFFFVFAYLLKREYWKDVH