Protein Info for GFF82 in Sphingobium sp. HT1-2

Annotation: Cytochrome c-type biogenesis protein CcmE, heme chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03100: CcmE
  • amino acids 34 to 129 (96 residues), 116.7 bits, E=2.6e-38

Best Hits

Swiss-Prot: 64% identical to CCME_NOVAD: Cytochrome c-type biogenesis protein CcmE (ccmE) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 85% identity to sch:Sphch_0804)

MetaCyc: 35% identical to periplasmic heme chaperone (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (3/11 steps found)

Protein Sequence (148 amino acids)

>GFF82 Cytochrome c-type biogenesis protein CcmE, heme chaperone (Sphingobium sp. HT1-2)
MKAKHQRLILALAALVAIIGAGLLAVSALKDEAAYFYAPNDVKTKGVEPGKAIRLGGMVV
KGSLKRAADGVTINFDVTDGKATVPATFSGIAPDLFKEGSGVVAEGAFDRQGRFVATNLL
AKHDERYMPRELDGMTYNETTHEMKAEP