Protein Info for GFF810 in Sphingobium sp. HT1-2

Annotation: Proton/glutamate symporter @ Sodium/glutamate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 334 to 345 (12 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details PF00375: SDF" amino acids 18 to 426 (409 residues), 372.9 bits, see alignment E=9.7e-116

Best Hits

KEGG orthology group: K03309, dicarboxylate/amino acid:cation (Na+ or H+) symporter, DAACS family (inferred from 69% identity to sal:Sala_0661)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>GFF810 Proton/glutamate symporter @ Sodium/glutamate symporter (Sphingobium sp. HT1-2)
MSGSGTEEQAGRRAAFSLQWQMLAGFLIGLTAGLVAYAVTPGAPWIDAVTRYLTGPIGQV
FLRLLFMLVIPLLVSALIVGIAEMGEMRSLRRVGLRTLIYTLIVSGIAVVISLALVNLLQ
PGSGVDPAQARALLADAGQGAKAILDRGADTPTGMQAVIAIVPDNVIAAMADNDILAVMV
FALFFGIGLVLVQTKETKLLLDAMEGLFAVTMRLISIVIRLAPIAIACFMFNLAAQFGWD
LLLRLSAYVGVVLLALAIQMFGIYSLLITLLARRSPLRFFAAVQEASVMAFATASSNATL
PTAIRVAEENLHLPRRIARFVLTIGATANQNGTAMFEGITVLFLAQFFHVDLSLGQQLMV
MLVCILGGVGTAGVPAGSLPVVAMILAMVGIPPEGIGLVLGVDRLLDMCRTALNVTGDLV
AATVISAREEISAAPSPPAPTR