Protein Info for GFF808 in Sphingobium sp. HT1-2

Annotation: Na+/H+-dicarboxylate symporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 47 to 72 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 293 to 344 (52 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details PF00375: SDF" amino acids 5 to 401 (397 residues), 387.3 bits, see alignment E=4.1e-120

Best Hits

Swiss-Prot: 40% identical to DCTA2_RHILO: C4-dicarboxylate transport protein 2 (dctA2) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: None (inferred from 92% identity to sjp:SJA_C1-01780)

Predicted SEED Role

"Na+/H+-dicarboxylate symporters" in subsystem Propionyl-CoA to Succinyl-CoA Module

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>GFF808 Na+/H+-dicarboxylate symporters (Sphingobium sp. HT1-2)
MRNRLTAYILTGMVLGVIVGFVANLWVGGDEALAKDVAGYFHLLADIFLHLIKMIIAPLV
FSTLVAGIAHMGDSAALGRIGGRALAWFIIASLISLTLGLIFVNFFEPGAGLNLVRSGAD
AGVNTEALNFRDFILHVFPTSMIGAMADNQILQIVVFSLFVGVALTAIGEKGKPIITVIE
ALVELMLQVTGYVMRVAPLAVFGALASSVTVQGLGVLKTYGALVGEFYIALICLWVLLFG
AGAIFLGKRMFKLIRYVREPILIAFSTASSEAAYPKMLEQLDRFGVPRRIYSFVLPLGYS
FNLDGSMMYATFATIFIAQAYGIDLPIATQITILLVLMVTSKGIAAVPRASLVVVAATLG
QFDLPVEGVAFILAVDHFMDMGRTATNVLGNAIATSVITKWEGMLEVEEPVDVPHPKAPA
HTPSHGRAGLELASDMVDEDRKG