Protein Info for GFF807 in Sphingobium sp. HT1-2

Annotation: 'Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 2 to 187 (186 residues), 230.3 bits, E=9.6e-73
• PF12766: Pyridox_oxase_2
  • amino acids 16 to 91 (76 residues), 32.5 bits, E=1.6e-11
• PF01243: PNPOx_N
  • amino acids 17 to 138 (122 residues), 100.2 bits, E=1.6e-32
• PF10590: PNP_phzG_C
  • amino acids 151 to 191 (41 residues), 56.6 bits, 2.9e-19

Best Hits

Swiss-Prot: 75% identical to PDXH_SPHAL: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 87% identity to sch:Sphch_1958)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (6/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• pyridoxal 5'-phosphate salvage I (3/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (3/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (191 amino acids)

>GFF807 'Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)' transl_table=11 (Sphingobium sp. HT1-2)
MTDPFALFDEWYAQARETELNDSNAMALATADAQGRPSVRMVLLKGHGPDGFIFYTNFEG
RKAGDLLANPHAALLFHWKSVRRQIRIEGSVGPVDDATADAYFATRSRDSQLGAWASDQS
RPLPSRAVFMDRYEEVRARFEGGPVPRPPHWSGFRLTPERIEFWQDREHRLHERRVFSRR
ENGWNEGLLYP