Protein Info for GFF806 in Xanthobacter sp. DMC5

Annotation: Major membrane protein I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF19307: SrpI-like" amino acids 57 to 305 (249 residues), 361.4 bits, see alignment E=9.5e-113

Best Hits

Swiss-Prot: 69% identical to SRPI_SYNE7: Protein SrpI (srpI) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: None (inferred from 84% identity to rpc:RPC_3636)

Predicted SEED Role

"Major membrane protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF806 Major membrane protein I (Xanthobacter sp. DMC5)
MTEEPAIRRTLNEAAARQLANATKTRAQWSGITPRWLVSFLPWTPVEAGIYRLNRVKEAN
GEIAADVECSPRRDQDPDLPETFVDYDEAPREYSLNAVTTILDVQTRVSDLYSHPYDQIQ
EQLRLLIEKVKEKQEAELINNAEYGLLTNAAPSQKIATRTGAPTPDDLDELITKVWKEPA
FFLAHPRAIAAFGRECTRRGVPPPTVTLFGTPFLTWRGLPLVPSDKLYVDENGKTNILLL
RTGEKKQGVIGLFQPGVPGEVAPSLSVRFMGINRKAIASYLVSLYCSAAVLTHDALAVLT
DVEVGKYHAYPDTYA