Protein Info for PS417_04095 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details PF00512: HisKA" amino acids 206 to 259 (54 residues), 27.1 bits, see alignment 3.6e-10 PF02518: HATPase_c" amino acids 313 to 412 (100 residues), 69.6 bits, see alignment E=3.1e-23

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 99% identity to pfs:PFLU0829)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U217 at UniProt or InterPro

Protein Sequence (420 amino acids)

>PS417_04095 histidine kinase (Pseudomonas simiae WCS417)
MLAAVKLTSATRQNLWRLTFIRTLVLAAQAGSVGLAYWFDLLPLPWLQLGVTLGFSTVLC
AFTAIRLRTTWPVTELEYALQLACDLFIHSVLLYFSGGSTNPFVSYYLVPLTIAAVTLPW
RYSVVLSGIALTLYTLLLARFYPLQTFPIARENLQIYGMWLSFALSAAVITFFAARMAEE
LRRQEELRAIRREEGLRDQQLLAVATQAAGAAHELGTPLATMSVLLNEMTQDHHDPALQE
DLGVLREQVKQCKQTLQQLVRAAEANRRLAVEMQDVTQWLDEALNRWHLMRPEASYRFHL
LGQGSVPRMAPPPDLTQALLNLLNNAADACPDGLGVQLDWDAEDVTISIRDHGAGVPLAI
AEQIGKPFFTTKGKGFGLGLFLSKASVTRAGGSVKLYSHEEGGTLTELRLPRVARGDIDE