Protein Info for GFF805 in Sphingobium sp. HT1-2

Annotation: Ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details PF03631: Virul_fac_BrkB" amino acids 36 to 288 (253 residues), 146.2 bits, see alignment E=7.2e-47 TIGR00765: YihY family inner membrane protein" amino acids 36 to 289 (254 residues), 79 bits, see alignment E=2.6e-26

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 82% identity to sjp:SJA_C1-01750)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>GFF805 Ribonuclease BN (Sphingobium sp. HT1-2)
MAAQAQEKFHRQIDRVRPGSRSFEIAKRVMVGVYSDGFIHAGNLAYLSLMTLFPFFIVAA
AVASVFGRTSDGLSAVNAFLYTVPRGVADVVRQPISDVLQARSGNLLWFGGLVGLWTVGS
LIETIRDILRRAYGTKSTKPFWRYRLASVGITLVSVLAVMFAFSMQVMITAVDQLLHRLL
PFADEAIAWVSSAKLVPMAILCVALHSLYVSLTPSLYRDKRFPKWPGAVATALWWYAVTL
LLPVTLSMLGGYDRTYGSLAGVMITLIFFFLVGLGVVIGAELNAALAEFPEDEAAGTVQD
KGNGTTI