Protein Info for GFF802 in Xanthobacter sp. DMC5

Annotation: Glutathione transport system permease protein GsiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 13 to 38 (26 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 170 (27 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 255 to 281 (27 residues), see Phobius details amino acids 300 to 326 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 13 to 113 (101 residues), 46.7 bits, see alignment E=3.5e-16 PF00528: BPD_transp_1" amino acids 126 to 331 (206 residues), 142.7 bits, see alignment E=1.1e-45

Best Hits

Swiss-Prot: 39% identical to GSIC_PECAS: Glutathione transport system permease protein GsiC (gsiC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 60% identity to xau:Xaut_2762)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF802 Glutathione transport system permease protein GsiC (Xanthobacter sp. DMC5)
MARALQLPEGRVLRYLGLRVVQVVPTILAIVVLNFFFLRLAPGDLAEVMAGEAGSATPEY
MAMLRQQFGLDEPLLVQFLKYMGQLFQLNLGYSFRNSMPVLDLILTRAPNTALLMLSSLV
LAVALGILFGAISAQWRGRWPDGVLSAFSTIGFATPLFWVGLMLIVLFSVELRWLPAGGM
RDLQQVHTGLAAVGDVALHMVLPVLSLAFFYIAIYTRLTRSAMLEVQELDFVRTARAKGI
APLPIAVRHVLRNALLPIVTMTGLQLGTLLSGSVVIETVFAWPGMGRLAFDAVFQRDINL
LLGVLFFSSFLVIVSNLATDLVYALLDPRIDVR