Protein Info for GFF801 in Xanthobacter sp. DMC5

Annotation: Glutathione transport system permease protein GsiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 99 to 102 (4 residues), see Phobius details amino acids 106 to 132 (27 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 121 to 303 (183 residues), 110.5 bits, see alignment E=4.4e-36

Best Hits

Swiss-Prot: 37% identical to Y4TQ_SINFN: Probable peptide ABC transporter permease protein y4tQ (NGR_a01420) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 59% identity to sme:SMa2083)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>GFF801 Glutathione transport system permease protein GsiD (Xanthobacter sp. DMC5)
MSLDATDILPRAAAPSAPATPKPRRAVRTSSFGYRFLRSRTALAGSIGLALVAGAALFAG
QIFPGDPLDMVARPFIWPFTSAEYPLGTDMLGRDILVGLVYAARVSLAVGLAAAGLAVAL
GVVFGALSGYFGGWVDQVLTRITEVFQTMPPLVFVVVVVAILTPSVSSIVLGIAVTSWPQ
VARLVRAEALRLRDAEFVQAARVMGMGHVRIILTHILPNAISPVVVAGSILVASAILTEA
ALSFLGLGDPNLISWGSMIGSGREVLRTAWYMTALPGLAISLTVMALNLLGNGLNDVLNP
RVSLT