Protein Info for GFF80 in Methylophilus sp. DMC18

Annotation: Aspartate/glutamate leucyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF04376: ATE_N" amino acids 21 to 90 (70 residues), 83.7 bits, see alignment E=8.9e-28 PF04377: ATE_C" amino acids 110 to 235 (126 residues), 142.3 bits, see alignment E=1.2e-45

Best Hits

Swiss-Prot: 63% identical to BPT_METFK: Aspartate/glutamate leucyltransferase (bpt1) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 63% identity to mmb:Mmol_1511)

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>GFF80 Aspartate/glutamate leucyltransferase (Methylophilus sp. DMC18)
MTLPNDAPLQKLQFYVTTAYTCGYLPKKLAQSLIATPQTLVDGRVYSGLIQQGFRRSGKF
AYRPHCEHCNACISVRLPVHAFEATRSQQRAFKKHAPLQAIIREASYDAEHFALYLTYQQ
QRHPSSLESAMPQEDEATQYQQFLCQSNVDSVMVEFRDAQQQLKMVSVIDIVMDGLSAVY
TFYDTHDKASYGTYSILWQIAWAKQLGLDYLYLGYWIADSQKMAYKQQFQPQEKLIDGVW
VR