Protein Info for GFF798 in Sphingobium sp. HT1-2

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 7 to 588 (582 residues), 663.9 bits, see alignment E=2.1e-203 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 8 to 448 (441 residues), 456.7 bits, see alignment E=9.1e-141 PF00270: DEAD" amino acids 21 to 179 (159 residues), 78.1 bits, see alignment E=1.7e-25 PF00271: Helicase_C" amino acids 216 to 320 (105 residues), 55.7 bits, see alignment E=1.4e-18 PF16124: RecQ_Zn_bind" amino acids 332 to 392 (61 residues), 54 bits, see alignment E=5.8e-18 PF09382: RQC" amino acids 394 to 504 (111 residues), 89.2 bits, see alignment E=4.4e-29 PF00570: HRDC" amino acids 522 to 586 (65 residues), 79.2 bits, see alignment E=4.4e-26

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 87% identity to sjp:SJA_C1-01670)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>GFF798 ATP-dependent DNA helicase RecQ (Sphingobium sp. HT1-2)
MPRDIPTLLHDIFGFTTFRGVQEQVVGRVMAGQPTLAIMPTGAGKSLCYQLPAVALDGCC
VVVSPLIALMHDQLRAATAVGIRAASLTSVDADWRETQDRLRNGELDLLYVAPERASGEG
FRNLLRSAKVALFAIDEAHCVSEWGHDFRPDYRLLRPLLDEFPDVPRLALTATADAHTRK
DILVQLGIPEDGLIISGFDRPNIRYAVHPRDGLTRQLADLLAANPGPGVVYAPTRAATEK
LAETLGRGGRAVRAYHAGMDPAQRAANQAAFIASEDMVMVATVAFGMGIDKPDVRFVAHA
GLPKSIEGYYQESGRAGRDGEPAVAHLFWGAEDFARARQRIMELEPARQQGERARIAALG
ALVETATCRRAILLRHFGEDPPATCGNCDNCLTPPASVDATETARKYLSAVYRTGQSFGA
GHIEAVLSGAVTDKIRERGHDKISVYAIVDGDETTLLRPVSRALLVRDALETTEHGGLML
GPNARPILRGEEEVRILVPPRRERKKRNARNGSDANPVGDPLFDALRTCRRELAQDAGVP
PYVIFHDSTLREMAEQRPATIHELGMVSGVGQKKLDAYGDAFLAAIRPYL